| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999258.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| PPQPPSAAAAAAAAAAPYHHLIQQQQQQLQMFWSYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRIDIFD FLVDIVPRDEIKDEASGLGGMVGATASG | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,120.108 | ||
| Theoretical pI: | 10.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 33.500 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999258.1 | 5prime_partial | 113 | 448-107(-) |
Amino Acid sequence : | |||
| TPLAVAPTIPPNPEASSLISSLGTISTKKSKISILVIAAAISFFCSVLRLFSSAWSHDRMVSSKMNNSQALANKIGASAEIMRTSSSAFMIFLMRASGSWWFLKSLTCSISCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,120.108 | ||
| Theoretical pI: | 10.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 33.500 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999258.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| PPQPPSAAAAAAAAAAPYHHLIQQQQQQLQMFWSYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRIDIFD FLVDIVPRDEIKDEASGLGGMVGATASG | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,120.108 | ||
| Theoretical pI: | 10.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 33.500 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999258.1 | 5prime_partial | 113 | 448-107(-) |
Amino Acid sequence : | |||
| TPLAVAPTIPPNPEASSLISSLGTISTKKSKISILVIAAAISFFCSVLRLFSSAWSHDRMVSSKMNNSQALANKIGASAEIMRTSSSAFMIFLMRASGSWWFLKSLTCSISCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,120.108 | ||
| Theoretical pI: | 10.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 33.500 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.265 | ||