Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999258.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
PPQPPSAAAAAAAAAAPYHHLIQQQQQQLQMFWSYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRIDIFD FLVDIVPRDEIKDEASGLGGMVGATASG | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,120.108 | ||
Theoretical pI: | 10.314 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 33.500 | ||
aromaticity | 0.080 | ||
GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.319 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999258.1 | 5prime_partial | 113 | 448-107(-) |
Amino Acid sequence : | |||
TPLAVAPTIPPNPEASSLISSLGTISTKKSKISILVIAAAISFFCSVLRLFSSAWSHDRMVSSKMNNSQALANKIGASAEIMRTSSSAFMIFLMRASGSWWFLKSLTCSISCR* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,120.108 | ||
Theoretical pI: | 10.314 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 33.500 | ||
aromaticity | 0.080 | ||
GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.319 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999258.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
PPQPPSAAAAAAAAAAPYHHLIQQQQQQLQMFWSYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRIDIFD FLVDIVPRDEIKDEASGLGGMVGATASG | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,120.108 | ||
Theoretical pI: | 10.314 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 33.500 | ||
aromaticity | 0.080 | ||
GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.319 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999258.1 | 5prime_partial | 113 | 448-107(-) |
Amino Acid sequence : | |||
TPLAVAPTIPPNPEASSLISSLGTISTKKSKISILVIAAAISFFCSVLRLFSSAWSHDRMVSSKMNNSQALANKIGASAEIMRTSSSAFMIFLMRASGSWWFLKSLTCSISCR* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,120.108 | ||
Theoretical pI: | 10.314 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 33.500 | ||
aromaticity | 0.080 | ||
GRAVY | 0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.319 | ||
sheet | 0.265 |