| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999268.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
| TCSLQNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIAGGVDSFAFKPGKYQAKKLCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRL TYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKHFSSIRQTGELWRTVSC | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,110.648 | ||
| Theoretical pI: | 5.904 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 31.459 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.220 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999268.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
| TCSLQNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIAGGVDSFAFKPGKYQAKKLCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRL TYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKHFSSIRQTGELWRTVSC | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,110.648 | ||
| Theoretical pI: | 5.904 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 31.459 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.220 | ||
| sheet | 0.242 | ||