Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999273.1 | 5prime_partial | 206 | 626-6(-) |
Amino Acid sequence : | |||
EDKRDMSIWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSIIM HIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 23,402.007 | ||
Theoretical pI: | 7.239 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 56.576 | ||
aromaticity | 0.068 | ||
GRAVY | -0.270 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.209 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999273.1 | 5prime_partial | 206 | 626-6(-) |
Amino Acid sequence : | |||
EDKRDMSIWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSIIM HIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 23,402.007 | ||
Theoretical pI: | 7.239 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 56.576 | ||
aromaticity | 0.068 | ||
GRAVY | -0.270 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.209 | ||
sheet | 0.306 |