| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999308.1 | internal | 111 | 1-333(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIHYPTSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQG | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,839.018 | ||
| Theoretical pI: | 5.418 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 33.109 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.297 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999308.1 | internal | 111 | 1-333(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIHYPTSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQG | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,839.018 | ||
| Theoretical pI: | 5.418 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 33.109 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.297 | ||
| sheet | 0.189 | ||