Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999310.1 | 5prime_partial | 164 | 2-496(+) |
Amino Acid sequence : | |||
LFLFNFCLYHTTMAVAGKLEVDTEIKSSADKFWGTIRDSTSIFPKAFSHDYKSIQVLKGDGKAPGSVRLITYADGSPIVKVSTEKIEHVDEAKKVVSYSVVDGDLLKYYKVFKGTITVTP KGDGSLVKWLSEYEKASDEIPDPAVIQEFVVKNFKEVDEYIQKA* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,325.714 | ||
Theoretical pI: | 5.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 11.609 | ||
aromaticity | 0.116 | ||
GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.195 | ||
sheet | 0.195 |