| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999311.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| LALHFCNMASSAVVLKLACFLLAASALIMAKAEITCQQVVSELAPCVSYVSNGGAVPVNCCNGVRTLYSAAQTTADRQNVCKCLKSAVSGISYTGFQLGLAAGLPSKCGLNIP | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,572.527 | ||
| Theoretical pI: | 8.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
| Instability index: | 26.279 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.257 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999311.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| LALHFCNMASSAVVLKLACFLLAASALIMAKAEITCQQVVSELAPCVSYVSNGGAVPVNCCNGVRTLYSAAQTTADRQNVCKCLKSAVSGISYTGFQLGLAAGLPSKCGLNIP | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,572.527 | ||
| Theoretical pI: | 8.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
| Instability index: | 26.279 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.257 | ||
| sheet | 0.310 | ||