| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999322.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| HGKVKLACEYKGVLPKVLLNVRQIYERFNADSIADVDDARLKYFTKKVFPKIKDSVQGGIMLFISSYFEFVRLRNFLKSQNASFCLLGDYTEPSDISRARVWFFEGKRKMMLYTERAHFF PDTRFVEFKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 15,368.737 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 22.862 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.169 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999322.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| HGKVKLACEYKGVLPKVLLNVRQIYERFNADSIADVDDARLKYFTKKVFPKIKDSVQGGIMLFISSYFEFVRLRNFLKSQNASFCLLGDYTEPSDISRARVWFFEGKRKMMLYTERAHFF PDTRFVEFKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 15,368.737 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 22.862 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.169 | ||
| sheet | 0.215 | ||