Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999325.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
NNMYRIMFDRRFESEDDPLFNRLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNEGLKCAIDHILDAQQKGEINEDNVLYIVENI NVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVPITEPDTQKLPYLQAVIKETLRLRMAIPLPVPHMNLHDAKLSGYDIPAESKILGERMVACKQPC | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 26,034.794 | ||
Theoretical pI: | 6.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 52.847 | ||
aromaticity | 0.080 | ||
GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.200 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999325.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
NNMYRIMFDRRFESEDDPLFNRLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNEGLKCAIDHILDAQQKGEINEDNVLYIVENI NVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVPITEPDTQKLPYLQAVIKETLRLRMAIPLPVPHMNLHDAKLSGYDIPAESKILGERMVACKQPC | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 26,034.794 | ||
Theoretical pI: | 6.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 52.847 | ||
aromaticity | 0.080 | ||
GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.200 | ||
sheet | 0.289 |