| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999327.1 | 5prime_partial | 103 | 430-119(-) |
Amino Acid sequence : | |||
| TENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSRFTKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,692.409 | ||
| Theoretical pI: | 10.100 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.327 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.291 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999327.1 | 5prime_partial | 103 | 430-119(-) |
Amino Acid sequence : | |||
| TENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSRFTKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,692.409 | ||
| Theoretical pI: | 10.100 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.327 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.291 | ||
| sheet | 0.184 | ||