Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999346.1	5prime_partial	165	3-500(+)
Amino Acid sequence :
QGKVKLACEYKGVLPKVLLNVRQIYERFNADSIADVDDARLEYFTKKVFPKIKDSVQGGIMLFISSYFEFVRLRNFLKSQNASFCLLGDYTEPSDISRARVWFFEGKRKMMLYTERAHFY HRYKIRGIQNLIIYSLPERKEFYPEIVNMLEGSHNMTCTVLFFPL*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		19,537.551
Theoretical pI:		9.319
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20400 20525
Instability index:		34.680
aromaticity		0.152
GRAVY		-0.195
Secondary Structure Fraction
Helix		0.382
turn		0.188
sheet		0.236