| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999347.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| LRIFTENSISPGPCRRQRGSRYTIRAGRYLCDKEFRYLRTVRVTAAVYRGFHSKQLTLLLLTFQHRAGVRLYTSCYHLAESCVFNKQSLPPGMCRFPKKKIGEHPFSRSYGVILPSSFDM VLSSALVYSTCSPVSVWG | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,776.203 | ||
| Theoretical pI: | 10.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17795 | ||
| Instability index: | 52.461 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.254 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999347.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| LRIFTENSISPGPCRRQRGSRYTIRAGRYLCDKEFRYLRTVRVTAAVYRGFHSKQLTLLLLTFQHRAGVRLYTSCYHLAESCVFNKQSLPPGMCRFPKKKIGEHPFSRSYGVILPSSFDM VLSSALVYSTCSPVSVWG | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,776.203 | ||
| Theoretical pI: | 10.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17795 | ||
| Instability index: | 52.461 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.254 | ||
| sheet | 0.188 | ||