Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999349.1 | 5prime_partial | 209 | 2-631(+) |
Amino Acid sequence : | |||
QIKTLSERTNAARASTSESGAKITISREEFESLSHKVEESDTLAEMKVAAAMAQVEAVKASENEALKKLEATQKEIEDMRAATEEALKRAEMAEAAKRAVEGELRRWREREQKKAAEAAA RILAETEMSSESSPHHYRIQKQKPSEKNIEVRKLDKEKISVSKKTLAPNISGIFHRKKNQIEGGSPSYLPGEKASITFAFADLCVIMKG* | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 23,214.102 | ||
Theoretical pI: | 8.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 57.017 | ||
aromaticity | 0.033 | ||
GRAVY | -0.730 | ||
Secondary Structure Fraction | |||
Helix | 0.191 | ||
turn | 0.177 | ||
sheet | 0.383 |