| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999350.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
| LVDDEGLACQFLFLWFINQLFICFNCRPVSCTNRALSSSVGYGHLACDCHQAFKSEVVSPGSFPALRLRRISSLMSTIFSLYPCFSSCFSSCLTRSIKDLSLSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,546.064 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 59.317 | ||
| aromaticity | 0.076 | ||
| GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999350.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| PTESERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHAKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTS | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,546.064 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 59.317 | ||
| aromaticity | 0.076 | ||
| GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999350.1 | internal | 105 | 316-2(-) |
Amino Acid sequence : | |||
| LVDDEGLACQFLFLWFINQLFICFNCRPVSCTNRALSSSVGYGHLACDCHQAFKSEVVSPGSFPALRLRRISSLMSTIFSLYPCFSSCFSSCLTRSIKDLSLSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,546.064 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 59.317 | ||
| aromaticity | 0.076 | ||
| GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999350.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| PTESERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHAKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTS | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,546.064 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 59.317 | ||
| aromaticity | 0.076 | ||
| GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.257 | ||