| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999382.1 | internal | 109 | 1-327(+) |
Amino Acid sequence : | |||
| RPRSTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSNTGFAMCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVN | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,790.567 | ||
| Theoretical pI: | 7.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 25.166 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.266 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999382.1 | internal | 109 | 1-327(+) |
Amino Acid sequence : | |||
| RPRSTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSNTGFAMCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVN | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,790.567 | ||
| Theoretical pI: | 7.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 25.166 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.266 | ||
| sheet | 0.284 | ||