Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999391.1 | 3prime_partial | 141 | 425-3(-) |
Amino Acid sequence : | |||
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRF | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,760.902 | ||
Theoretical pI: | 10.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 48.252 | ||
aromaticity | 0.099 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.312 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999391.1 | 3prime_partial | 141 | 425-3(-) |
Amino Acid sequence : | |||
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRF | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,760.902 | ||
Theoretical pI: | 10.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 48.252 | ||
aromaticity | 0.099 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.312 | ||
sheet | 0.170 |