Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999412.1 | 5prime_partial | 207 | 2-625(+) |
Amino Acid sequence : | |||
VVLTSSISAIVPNPNWPKGKVFDETSWTDLDFCQANKIWYSMSKTLAEKAAWEFAEKNGLDVVSIHPATSLGPFPQPYLNASGAVLQRLLKGSKDTQEHYWLGAVHVQDVAKAQVLLFES PAASGRYLCTNGIYQFAEFAEKVSKLFPEFPIHRFNGETQPGLKACPDAAKRLIDLGLVFTPVEVAVREAVESLIAQGYLGQQNLKS* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 22,783.732 | ||
Theoretical pI: | 6.111 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 28.852 | ||
aromaticity | 0.106 | ||
GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.237 | ||
sheet | 0.275 |