| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JN114739.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| VQLLRYWVKDASSLHLLRSFLHEHFNLNWNSLISSKNSISFFSNRNSRLLLFLYNSHVYEYESIFFGLCNQFSHLRSTSSGALVERIDFYRKVDDLVEVFTNDFPGILWLFKDPFMHYVR YQGKFILASKDTPLLMNKWKYYLVNLWQWH | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 18,173.628 | ||
| Theoretical pI: | 9.213 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46410 | ||
| Instability index: | 34.469 | ||
| aromaticity | 0.193 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.447 | ||
| turn | 0.233 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JN114739.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| VQLLRYWVKDASSLHLLRSFLHEHFNLNWNSLISSKNSISFFSNRNSRLLLFLYNSHVYEYESIFFGLCNQFSHLRSTSSGALVERIDFYRKVDDLVEVFTNDFPGILWLFKDPFMHYVR YQGKFILASKDTPLLMNKWKYYLVNLWQWH | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 18,173.628 | ||
| Theoretical pI: | 9.213 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46410 | ||
| Instability index: | 34.469 | ||
| aromaticity | 0.193 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.447 | ||
| turn | 0.233 | ||
| sheet | 0.220 | ||