Acc_NO	ORF type	length	start-end position (strand +/-)
>JN114828.1	internal	204	2-613(+)
Amino Acid sequence :
GFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALR ALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWR
Physicochemical properties
Number of amino acids:		204
Molecular weight:		22,884.755
Theoretical pI:		7.765
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35870 36120
Instability index:		31.591
aromaticity		0.123
GRAVY		-0.414
Secondary Structure Fraction
Helix		0.314
turn		0.230
sheet		0.230