Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN114828.1 | internal | 204 | 2-613(+) |
Amino Acid sequence : | |||
GFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALR ALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWR | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,884.755 | ||
Theoretical pI: | 7.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 31.591 | ||
aromaticity | 0.123 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.230 | ||
sheet | 0.230 |