Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN114986.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGVAKSKIRGKELIVWEILQEVMQGHPVLLNRAPTLHKLGIQAFQPILVEGRAICLHPLVCKGF NADFDGDQMAVHVPLSLEAQAEARLL | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,203.927 | ||
Theoretical pI: | 9.256 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 34.782 | ||
aromaticity | 0.055 | ||
GRAVY | 0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.199 | ||
sheet | 0.295 |