Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN244340.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
ASSLHLLRFFLHEYWNLNSLITSKKPGYSFSKKNKRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIARLVKVFAKDFQVTLWLFKDPFMHYVRYQGKSILASKGT FLFMNKWKFYLVNFWQCHFSLCFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMFENSFLINNAIKKFDTLVPIIPLIGSLAKANFCTVLGHPISKPVWSDLSDSDIIDRFGRICR NLF | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 28,757.131 | ||
Theoretical pI: | 9.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44140 | ||
Instability index: | 35.697 | ||
aromaticity | 0.181 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.407 | ||
turn | 0.239 | ||
sheet | 0.189 |