Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN244358.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQ | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 24,793.995 | ||
Theoretical pI: | 8.764 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 24.180 | ||
aromaticity | 0.127 | ||
GRAVY | -0.365 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.209 | ||
sheet | 0.241 |