| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JN368071.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
| FDTWGELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRTDAEIGPPCFVCGGSKCRPLLGLALRMVDEYIVVCAYSPCPCPQQCDVSSSDPSPRTLSASE* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,376.900 | ||
| Theoretical pI: | 7.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
| Instability index: | 56.286 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.324 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JN368071.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
| FDTWGELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRTDAEIGPPCFVCGGSKCRPLLGLALRMVDEYIVVCAYSPCPCPQQCDVSSSDPSPRTLSASE* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,376.900 | ||
| Theoretical pI: | 7.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
| Instability index: | 56.286 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.324 | ||
| sheet | 0.190 | ||