Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587616.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
DMQLISEAYDVLKSVGKLSXEELKDVFTDWNKGELQSFLIEITADIFGIKDXKGXGFLVDKVLDKTGMKGTGKWTVQQAAELSIAAPXXEASLDSRFMSGLKEERTEAAKVFXXGDIIGD QEVXKEKLIXDVRQALYASKICSYAQGMNLIRAKSIEKEWDLKLGELARIW | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,094.583 | ||
Theoretical pI: | 4.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26470 | ||
Instability index: | 29.698 | ||
aromaticity | 0.080 | ||
GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.167 | ||
sheet | 0.309 |