Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587708.1 | internal | 116 | 350-3(-) |
Amino Acid sequence : | |||
LADPQAIYGLKYMLLCKIMVNQAEDVXGIISSPKVGLQYKGPELDAMKAIADAHSKRSLKLFETALQNFKNELDEDPIVHRHLSALYDTLQEQNLCRLIEPFSRVEIAHIAELIEL | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,003.939 | ||
Theoretical pI: | 5.285 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 49.864 | ||
aromaticity | 0.061 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.165 | ||
sheet | 0.357 |