Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587729.1 | complete | 110 | 622-954(+) |
Amino Acid sequence : | |||
MQASLLGEAVTGKGILSQLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGRFVDDAPATGLDKAVIAPGKGFRSALGLGDGNFFHNLSFFLNNLEKIKLSIDHINRV* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,769.496 | ||
Theoretical pI: | 5.543 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 12.678 | ||
aromaticity | 0.091 | ||
GRAVY | 0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.273 | ||
sheet | 0.318 |