Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587787.1 | internal | 227 | 1-681(+) |
Amino Acid sequence : | |||
HFMSSWAAICSGATSVPVPPFLDRTKARNTRVKLDLSQPSDAPEHANSAAPVLRGKVFKFPASAIAQIKSKVNNNNNDKKGFSTFQSLSAHVWQAVTRARELGPTEYTVFTVFADCRKRV DPAMPESYFGNLIQAIFTVTGAGLILSSPAEFGAGLIRGAIESHDAEAIKKRNEEWESKPVIFGYKDAGVNCVAVGSSPRFQVYEVDFGWGSPESVRSGLNNRFDGM | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 10,632.085 | ||
Theoretical pI: | 10.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 58.482 | ||
aromaticity | 0.091 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.374 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587787.1 | internal | 227 | 681-1(-) |
Amino Acid sequence : | |||
HPIEPVVEPAPDALRAAPPEIHLVHLEPRRAPHRHAVHPRVLVPEYHRLALPLLVPLLYRLRIVRLDRPPDQPRPELGRARQDQPRPGHREYCLDQVPEIALGHGRVDPLPAVREHREHR VLRGPQLPRPRHCLPHVRRQRLERGEALLVVVVVVDFGLDLGDGGGRELEDLAAEDGGGGVGVLGRVGGLGEVQLHAGVSRLGAVQEWWDRHRGGPTADGCPRAHEV | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 10,632.085 | ||
Theoretical pI: | 10.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 58.482 | ||
aromaticity | 0.091 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.374 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587787.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
LHELVGSHLQWGHLGAGPTIPGPHQGAKHPREAGPLPALRRARARQLRRPRPPRQGLQVPGLRHRPDQVQSQQQQQRQEGLLHVPVAVGARVAGSDAGEGAGAHGVHGVHGVRGLQEAGR PGHARELFREPDPGNIHGDRGGADPVEPGRVRGGADQGGDRVARCGGDKEEERGVGEQAGDIRVQGRGGELRGGGELAAVPGVRGGFRVGQPGERPERAQQPVRWD | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 10,632.085 | ||
Theoretical pI: | 10.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 58.482 | ||
aromaticity | 0.091 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.374 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587787.1 | 3prime_partial | 123 | 371-3(-) |
Amino Acid sequence : | |||
MAGSTRFLQSANTVNTVYSVGPSSLARVTACHTCADSDWNVEKPFLSLLLLLTLDLIWAMAEAGNLKTLPRRTGAAELACSGASEGWERSSFTRVFRALVRSRNGGTGTEVAPLQMAAHE LMK | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 10,632.085 | ||
Theoretical pI: | 10.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 58.482 | ||
aromaticity | 0.091 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.374 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587787.1 | 5prime_partial | 99 | 680-381(-) |
Amino Acid sequence : | |||
IPSNRLLSPLRTLSGLPHPKSTSYTWNRGELPTATQFTPASLYPNITGLLSHSSFLFFIASASCDSIAPLISPAPNSAGLDRISPAPVTVNIAWIRFPK* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,632.085 | ||
Theoretical pI: | 10.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 58.482 | ||
aromaticity | 0.091 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.374 | ||
sheet | 0.222 |