Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587790.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
KLDLSQPSDAPEHANSASSNGDAPVLRGKVFKFXASAIDQIKAXVNNSXSTDSKPKPFSTFQSLSAHVWQAVTRARELGPTDYXVFTVFADCRKRVDPXMXESYFGNLIQAIFTVTGXGL ILSXPVXFGAGLIRGAIESHDAEAIKKRNEEWESKPVIFEYKDAGVXCVAVGSSPRFQVYGVDFGWGSPESV | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 16,755.652 | ||
Theoretical pI: | 5.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 27.812 | ||
aromaticity | 0.013 | ||
GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.256 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN587790.1 | 5prime_partial | 166 | 576-76(-) |
Amino Acid sequence : | |||
HAFRAAPPEIHPVHLEPGRAPHRHAXHPGVLVLEYHRLALPLLVPLLDRLGVVRLDRPPDQPRPEXHRXGQDQTXPGHREDRLDQVPEVALXHXRVDPLAAVGEHREHXVVGGAELTRAG HGLPHVRGERLEGGEGLGLGVGGXGVVDXGLDLVNGGGXELEDLAT* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 16,755.652 | ||
Theoretical pI: | 5.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 27.812 | ||
aromaticity | 0.013 | ||
GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.256 | ||
sheet | 0.314 |