Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN796937.1 | internal | 222 | 1-666(+) |
Amino Acid sequence : | |||
YKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQVETGEIKGHYLM | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 25,149.405 | ||
Theoretical pI: | 8.276 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 26.262 | ||
aromaticity | 0.126 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.203 | ||
sheet | 0.248 |