Acc_NO	ORF type	length	start-end position (strand +/-)
>JN891548.1	internal	168	2-505(+)
Amino Acid sequence :
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPK
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,753.171
Theoretical pI:		8.768
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27390 27515
Instability index:		18.773
aromaticity		0.119
GRAVY		-0.331
Secondary Structure Fraction
Helix		0.321
turn		0.208
sheet		0.226