Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN891548.1 | internal | 168 | 2-505(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPK | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,753.171 | ||
Theoretical pI: | 8.768 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 18.773 | ||
aromaticity | 0.119 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.208 | ||
sheet | 0.226 |