Acc_NO	ORF type	length	start-end position (strand +/-)
>JN893282.1	internal	180	2-541(+)
Amino Acid sequence :
SVGFKAGVKDYRLTYYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV
Physicochemical properties
Number of amino acids:		180
Molecular weight:		19,831.282
Theoretical pI:		8.445
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27390 27515
Instability index:		26.092
aromaticity		0.117
GRAVY		-0.301
Secondary Structure Fraction
Helix		0.317
turn		0.239
sheet		0.228