Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN893654.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPVAYVKTFQGPPHGIQVERDK | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,920.927 | ||
Theoretical pI: | 5.211 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 26.845 | ||
aromaticity | 0.125 | ||
GRAVY | -0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.211 | ||
sheet | 0.230 |