Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN894228.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
RVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSILASKGTSLFMNKW KLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRFSRICRNISHYHS GSCK | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 29,156.734 | ||
Theoretical pI: | 9.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57660 | ||
Instability index: | 45.179 | ||
aromaticity | 0.148 | ||
GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.242 | ||
sheet | 0.205 |