Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JN895176.1 | internal | 273 | 3-821(+) |
Amino Acid sequence : | |||
RHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSI LASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDR FSRICRNISHYHSGSCKKRSLYRIKYILRLSCA | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 32,693.969 | ||
Theoretical pI: | 10.125 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 65890 66265 | ||
Instability index: | 47.515 | ||
aromaticity | 0.143 | ||
GRAVY | -0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.231 | ||
sheet | 0.209 |