Acc_NO	ORF type	length	start-end position (strand +/-)
>JN895462.1	internal	233	2-700(+)
Amino Acid sequence :
SLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKHFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMN KWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRI
Physicochemical properties
Number of amino acids:		233
Molecular weight:		27,650.828
Theoretical pI:		9.673
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39880 40130
Instability index:		33.348
aromaticity		0.176
GRAVY		-0.008
Secondary Structure Fraction
Helix		0.412
turn		0.227
sheet		0.193