Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ024964.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
PFLHLLQFFLHEYHNWNNLLITQKKSIYVFSKENKRLFRFLYNSYVFECEFLLVFFRTQSSYLRLTFFGTFIEQTHFYGKIEHFQIEHFLLVCRNAFHRTLWFFKDPFMHYVRYQGKVIL ASKGTYLLMKKWKYHFVNFWQYYFHFWSQPYRIHINQLSNYSFYFLGYLSSLLRNSLAVRNQMLENSFLLDTVTKKFDTIIPVFLLIGSLSKAKICTVSGHPISKPIWADLSDSDILDRF GRICRNLSHYYSGSSKKQGLY | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 31,680.380 | ||
Theoretical pI: | 9.665 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61310 61560 | ||
Instability index: | 38.762 | ||
aromaticity | 0.211 | ||
GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
Helix | 0.444 | ||
turn | 0.199 | ||
sheet | 0.192 |