| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ024964.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| PFLHLLQFFLHEYHNWNNLLITQKKSIYVFSKENKRLFRFLYNSYVFECEFLLVFFRTQSSYLRLTFFGTFIEQTHFYGKIEHFQIEHFLLVCRNAFHRTLWFFKDPFMHYVRYQGKVIL ASKGTYLLMKKWKYHFVNFWQYYFHFWSQPYRIHINQLSNYSFYFLGYLSSLLRNSLAVRNQMLENSFLLDTVTKKFDTIIPVFLLIGSLSKAKICTVSGHPISKPIWADLSDSDILDRF GRICRNLSHYYSGSSKKQGLY | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 31,680.380 | ||
| Theoretical pI: | 9.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61310 61560 | ||
| Instability index: | 38.762 | ||
| aromaticity | 0.211 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.444 | ||
| turn | 0.199 | ||
| sheet | 0.192 | ||