Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ025049.1	internal	184	1-552(+)
Amino Acid sequence :
SVGFKAGVKDYKLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEKVIGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFEGPPHGIQAERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECL
Physicochemical properties
Number of amino acids:		184
Molecular weight:		20,311.901
Theoretical pI:		8.240
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30370 30620
Instability index:		25.793
aromaticity		0.120
GRAVY		-0.318
Secondary Structure Fraction
Helix		0.310
turn		0.234
sheet		0.245