Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ273661.1 | complete | 134 | 1-405(+) |
Amino Acid sequence : | |||
MNLNLCVLTPNRIILDSEVKEIILSTNSGQIGILPNHASIATAVDIGLLRIRRNDQWLTVALMGGFARVSNNEITILGNDAEMSTDINPEEAQQALEIAEANLSGAQGKRQAIEANLALR RARTRVEALNVISN* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,527.410 | ||
Theoretical pI: | 5.130 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 48.310 | ||
aromaticity | 0.015 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.246 | ||
sheet | 0.336 |