Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ273710.1 | complete | 184 | 1-555(+) |
Amino Acid sequence : | |||
MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLNDLLDNRKQRILSTIRNSEELRRGAIEQLERARARLQKVEIEADEYRMNGYSEIEREKVNLINATSYSLEQ LENYKNETLHFEQQRTINQVRQEVFQQALQGALRTLSSCLTSELHFRTISANIGILGAMEEITD* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,919.385 | ||
Theoretical pI: | 5.500 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 45.642 | ||
aromaticity | 0.071 | ||
GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.223 | ||
sheet | 0.293 |