| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ273710.1 | complete | 184 | 1-555(+) |
Amino Acid sequence : | |||
| MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLNDLLDNRKQRILSTIRNSEELRRGAIEQLERARARLQKVEIEADEYRMNGYSEIEREKVNLINATSYSLEQ LENYKNETLHFEQQRTINQVRQEVFQQALQGALRTLSSCLTSELHFRTISANIGILGAMEEITD* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,919.385 | ||
| Theoretical pI: | 5.500 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 45.642 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.223 | ||
| sheet | 0.293 | ||