Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ273759.1 | complete | 247 | 1-744(+) |
Amino Acid sequence : | |||
MNVIPCSIKTLKGLYDISGVEVGQHLYWQIGGLQIHAQVLITSWVVIAILLGSVIIAVRDPQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 27,092.524 | ||
Theoretical pI: | 5.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 40910 | ||
Instability index: | 25.643 | ||
aromaticity | 0.117 | ||
GRAVY | 0.667 | ||
Secondary Structure Fraction | |||
Helix | 0.445 | ||
turn | 0.235 | ||
sheet | 0.255 |