| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ273956.1 | complete | 184 | 1-555(+) |
Amino Acid sequence : | |||
| MNWRSEHIWIELITGSRKASNFCWACILFLGSLGFLVVGTSSYLGRNLIPGFPSQQIIFFPQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIMCIFRWGFPGINRRIFLRF FMKDIQSIRMEVKEGLFPRRILYMEIRGQGTIPLTRTDENFTPREIEQKAAELAYFLRVPIEVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 21,467.898 | ||
| Theoretical pI: | 9.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42190 | ||
| Instability index: | 59.034 | ||
| aromaticity | 0.163 | ||
| GRAVY | 0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.402 | ||
| turn | 0.239 | ||
| sheet | 0.207 | ||