| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ274005.1 | complete | 167 | 1-504(+) |
Amino Acid sequence : | |||
| MPRSRINGNFIDKTSSIIANILLRIIPTTSGEKKAFTYYRDMSAQSEGNYAEALQNYYEAMRSEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYRGE QAILQGDSEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWLKITRRFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,361.485 | ||
| Theoretical pI: | 5.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
| Instability index: | 59.938 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.222 | ||
| sheet | 0.281 | ||