| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ274202.1 | complete | 123 | 1-372(+) |
Amino Acid sequence : | |||
| MPTIKQLIRNTRQPIRNMTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVK KPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,796.081 | ||
| Theoretical pI: | 11.578 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 46.304 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.244 | ||
| sheet | 0.138 | ||