Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ274202.1 | complete | 123 | 1-372(+) |
Amino Acid sequence : | |||
MPTIKQLIRNTRQPIRNMTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVK KPK* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,796.081 | ||
Theoretical pI: | 11.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 46.304 | ||
aromaticity | 0.041 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.244 | ||
sheet | 0.138 |