Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ274251.1 | complete | 155 | 1-468(+) |
Amino Acid sequence : | |||
MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLSVLRQAIRRVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKF SSELVDAAKGSGDAVRKKEETHRMAEANRAFAHFR* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,476.130 | ||
Theoretical pI: | 11.385 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 43.704 | ||
aromaticity | 0.052 | ||
GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.194 | ||
sheet | 0.271 |