| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JQ274251.1 | complete | 155 | 1-468(+) |
Amino Acid sequence : | |||
| MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLSVLRQAIRRVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKF SSELVDAAKGSGDAVRKKEETHRMAEANRAFAHFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,476.130 | ||
| Theoretical pI: | 11.385 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 43.704 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.194 | ||
| sheet | 0.271 | ||