Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ274300.1	complete	201	1-606(+)
Amino Acid sequence :
MSRYRGPRFKKIRRLGALPGLTSKRPRSGSDLKNQLRSAKRSQYRIRLEEKQKLRFHYGLTERQLLRYVHIAGKAKGSTGQVLLQLLEMRLDNILFRLGMASTIPGARQLVNHRHILVNG RIVDIPSFRCKPRDIITTKEKQRSKALIQNSIASSPHEELPNHLTVDSIQYKGLVNQIIDSKWIGLKINELLVVEYYSRQT*
Physicochemical properties
Number of amino acids:		201
Molecular weight:		23,247.885
Theoretical pI:		10.888
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 15930
Instability index:		50.139
aromaticity		0.060
GRAVY		-0.533
Secondary Structure Fraction
Helix		0.318
turn		0.224
sheet		0.229