Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ274639.1 | complete | 139 | 1-420(+) |
Amino Acid sequence : | |||
MLSINYNPKKTRFRKQHRGRMKGISCRGNRICFGRYALQALEPAWITARQIEAGRRAMTRYARRGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVART AISIAACKMPIRTQFVISR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,846.510 | ||
Theoretical pI: | 11.460 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 45.582 | ||
aromaticity | 0.086 | ||
GRAVY | -0.434 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.230 | ||
sheet | 0.194 |