Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ274882.1	complete	100	1-303(+)
Amino Acid sequence :
MARKCLIQREKKRQKLEQKYHLIRRSSKKEIRAVLSLSEKWEIHGKLQSPPRNSAPIRLHRRCFLTGRSRANYRDFGLSGHVLREIVHACLLPGATRSSW*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,771.675
Theoretical pI:		11.308
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		78.736
aromaticity		0.060
GRAVY		-0.753
Secondary Structure Fraction
Helix		0.270
turn		0.210
sheet		0.250