Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ274931.1	complete	138	1-417(+)
Amino Acid sequence :
MAKPIPRISSRRNGRIGSRKNGRRIPKGVIHVQASFHNTIVTVTDVRGRVVSWASAGTSGFKGTRRGTPYAAQAAAENAIRTVIDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVR DVTPMPHNGCRPPKKRRV*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,031.338
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		39.735
aromaticity		0.036
GRAVY		-0.438
Secondary Structure Fraction
Helix		0.232
turn		0.275
sheet		0.174