Acc_NO	ORF type	length	start-end position (strand +/-)
>JQ275176.1	complete	122	1-369(+)
Amino Acid sequence :
MIQPQTLLNVADNSGARELMCIRIIGAGNHRYAHIGDIIVAVIKEAVPNMPLERSEVIRAVIVRTCKELKRDNGMIIRYDDNAAVVIDQEGNPKGTRVFGAIARELRQLNFTKIVSLAPE VL*
Physicochemical properties
Number of amino acids:		122
Molecular weight:		13,517.659
Theoretical pI:		8.709
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		26.957
aromaticity		0.033
GRAVY		0.053
Secondary Structure Fraction
Helix		0.328
turn		0.197
sheet		0.270