Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ276353.1 | complete | 229 | 1-690(+) |
Amino Acid sequence : | |||
MKKKKVLTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNTRKSETFLNDIQEKIFLEKFLELEELFLLDEMIKEYPETHIQKLRIGIHKETIQLVKTHNEYHLHIVLHLSTNIISFAIL SGYFFLGNEELVILNSWVQEFFYNLSDTIKAFSILLVTDLWIGFHSTHGWELMIGLIYNDFGLAHNDQIISSLVSTFPVILDTIVKYWIFRFLNRVSPSLVVIYHSMNE* | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 27,153.343 | ||
Theoretical pI: | 5.917 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61420 | ||
Instability index: | 33.632 | ||
aromaticity | 0.148 | ||
GRAVY | 0.251 | ||
Secondary Structure Fraction | |||
Helix | 0.467 | ||
turn | 0.192 | ||
sheet | 0.253 |