Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JQ276549.1 | complete | 120 | 1-363(+) |
Amino Acid sequence : | |||
MFLLHEYDIFWAFLIISGVIPILAFVISGVLAPVSEGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVIFDVETVFLYPWAMSLDVLGVSVFIEAFIFVLILIVGSVYAWRKGALEWS * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,699.059 | ||
Theoretical pI: | 4.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 38.004 | ||
aromaticity | 0.192 | ||
GRAVY | 1.048 | ||
Secondary Structure Fraction | |||
Helix | 0.533 | ||
turn | 0.192 | ||
sheet | 0.292 |